Recombinant Turkey astrovirus 1 Non-structural polyprotein 1AB(ORF1)

Code CSB-CF862348TGAL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9JH69
Storage Buffer Tris-based buffer,50% glycerol
Species Turkey astrovirus 1 (TAstV-1)
Sequence QRKKTCRTCGETRPHNHKMCRDRHTRRFCFWCGVVHSDVEGHSRDLKCPKCSAGFANLRE MEQHAVTTCSKKLDSHPEPSRVFQPLDFGLGIFDWRFDLQPIRHHVAVPMNVEVLGYIPV DRLVERRNVITDPLLKLVEPWRQETYGPAVWTIKAYNKMFEKFFYSEPLEFAQLDSSILN LADSYCLQEHDYMSGSQIVPITSTEKNLDSTPGYPKFKVFSTEREYLSTCGWDEYKTVWQ VGPREKPLWWCFLKTEVLKLAKIEQDDIRMILCTDPVFTRIGAAFEQHQNSLMKLETENH HAQVGWSPFFGGIHRRATRLYGEHRYYVELDWTRFDGTIPPELFRRIKLMRFFLLDPKYK TPENRDRYNWYVENLIDKVVLLPTGEVCKIYGGNPSGQFSTTVDNNFVNVWLTVFELAYL FYKEHNRLPTICEIKKHTDWICYGDDRLLAVDKRFINSYDTAAVIAMYKDVFGMWVKPDN IKVFPSLEGVSFCGMVWTKRKGQYVGKPNVDKILSTLSDPVSRLPDIQSLWGKLVSLRLL CENESDEVVDYLDKQIESVSRHAKEAGIALPKIGPDFYAEIWID
Source in vitro E.coli expression system
Gene Names ORF1
Protein Names Recommended name: Non-structural polyprotein 1AB Cleaved into the following 5 chains: 1. Protein p19 2. Transmembrane protein 1A 3. Serine protease p27 Short name= 4. p27 EC= 5. 3.4.21.- 6. Protein p20 7. RNA-directed
Expression Region 1028-1611
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Non-structural polyprotein 1AB
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families Astroviridae polyprotein 1AB family

Related Products

ORF1 Proteins

ORF1 Proteins for Turkey astrovirus 1 (TAstV-1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.