Recombinant Turkey astrovirus 1 Non-structural polyprotein 1AB(ORF1)

Code CSB-CF862348TGAL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9JH69
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Turkey astrovirus 1 (TAstV-1)
Sequence QRKKTCRTCGETRPHNHKMCRDRHTRRFCFWCGVVHSDVEGHSRDLKCPKCSAGFANLRE MEQHAVTTCSKKLDSHPEPSRVFQPLDFGLGIFDWRFDLQPIRHHVAVPMNVEVLGYIPV DRLVERRNVITDPLLKLVEPWRQETYGPAVWTIKAYNKMFEKFFYSEPLEFAQLDSSILN LADSYCLQEHDYMSGSQIVPITSTEKNLDSTPGYPKFKVFSTEREYLSTCGWDEYKTVWQ VGPREKPLWWCFLKTEVLKLAKIEQDDIRMILCTDPVFTRIGAAFEQHQNSLMKLETENH HAQVGWSPFFGGIHRRATRLYGEHRYYVELDWTRFDGTIPPELFRRIKLMRFFLLDPKYK TPENRDRYNWYVENLIDKVVLLPTGEVCKIYGGNPSGQFSTTVDNNFVNVWLTVFELAYL FYKEHNRLPTICEIKKHTDWICYGDDRLLAVDKRFINSYDTAAVIAMYKDVFGMWVKPDN IKVFPSLEGVSFCGMVWTKRKGQYVGKPNVDKILSTLSDPVSRLPDIQSLWGKLVSLRLL CENESDEVVDYLDKQIESVSRHAKEAGIALPKIGPDFYAEIWID
Source in vitro E.coli expression system
Gene Names ORF1
Protein Names Recommended name: Non-structural polyprotein 1AB Cleaved into the following 5 chains: 1. Protein p19 2. Transmembrane protein 1A 3. Serine protease p27 Short name= 4. p27 EC= 5. 3.4.21.- 6. Protein p20 7. RNA-directed
Expression Region 1028-1611
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Non-structural polyprotein 1AB
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families Astroviridae polyprotein 1AB family

Related Products

ORF1 Proteins

ORF1 Proteins for Turkey astrovirus 1 (TAstV-1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.