Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A(ORF1)

Code CSB-CF862325TGAK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9ILI6
Storage Buffer Tris-based buffer,50% glycerol
Species Turkey astrovirus 2 (TAstV-2)
Sequence AKGKTKKTVRGRKHLVTKRALGKGHFMKMRMLTDEEYQNMIEKGFSAEEIREAVNALREQ AWLNYCIDNDVDDEGEEDWYDDMVETDRVNQEIDEAIERAMEDRGEFYQKKSRLTFVEQA MMHLIQVSKERSQTAKLEVQKENEAQLVKMFERCVTDENTPEGTTSIAALSTEDDVRLVE GKVIDFTKAKNIPVDGEIRREIIPGTKCTEISTGPENKKNILKKKDTHIAEGKVETKSSQ QPVDVKDDKPVALEQRKPRACKWCGSSQKHDYRECRFQREKRFCVYCAAMHSMFEGHIRP IECTSCKKSFSGIEKLEDHVVSGECQKN
Source in vitro E.coli expression system
Gene Names ORF1
Protein Names Recommended name: Non-structural polyprotein 1A Cleaved into the following 4 chains: 1. Protein p19 2. Transmembrane protein 1A 3. Serine protease p27 Short name= 4. p27 EC= 5. 3.4.21.- 6. Protein p20'
Expression Region 798-1125
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Non-structural polyprotein 1A
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families Astroviridae polyprotein 1A family

Related Products

ORF1 Proteins

ORF1 Proteins for Turkey astrovirus 2 (TAstV-2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.