Recombinant Turkey rhinotracheitis virus Major surface glycoprotein G(G)

Code CSB-CF329265TJK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P33495
Storage Buffer Tris-based buffer,50% glycerol
Species Turkey rhinotracheitis virus (TRTV)
Sequence MGSKLYMVQGTSAYQTAVGFWLDIGRRYILAIVLSAFGLTCTVTIALTVSVIVEQSVLEE CRNYNGGDRDWWSTTQEQPTTAPSATPAGNYGGLQTARTRKSESCLHVQISYGDMYSRSD TVLGGFDCMGLLVLCKSGPICQRDNQVDPTALCHCRVDLSSVDCCKVNKISTNSSTTSEP QKTNPAWPSQDNTDSDPNPQGITTSTATLLSTSLGLMLTSKTGTHKSGPPQALPGSNTNG KTTTDREPGPTNQPNSTTNGQHNKHTQRMTPPPSHDNTRTILQHTTPWEKTFSTYKPTHS PTNESDQSLPTTQNSINCEHFDPQGKEKICYRVGSYNSNITKQCRIDVPLCSTYSTVCMK TYYTEPFNCWRRIWRCLCDDGVGLVEWCCTS
Source in vitro E.coli expression system
Gene Names G
Protein Names Recommended name: Major surface glycoprotein G Alternative name(s): Attachment glycoprotein G
Expression Region 1-391
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function It is likely to be the virus attachment protein.
Subcellular Location Host cell surface, Virion membrane

Related Products

G Proteins

G Proteins for Turkey rhinotracheitis virus (TRTV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.