Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme(pilD)

Code CSB-CF335844NFZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P33566
Storage Buffer Tris-based buffer,50% glycerol
Species Neisseria gonorrhoeae
Sequence MSDLSVLSPFAVPLAAVLGLLVGSFLNVVIYRVPVMMERGWTVFAKEHLNLPLTDDESRT FNLMKPDSCCPKCRVPIRAWQNIPIVSYLLLRGKCASCQTKISIRYPLIELLTGVLFGLV AWQYGWSWITLGGLILTAFLISLTFIDADTQYLPDSMTLPLIWLGLIFNLDGGFVPLQSA VLGAVAGYSSLWLLCAVYKLLTGKTGMGNGDFKLIAALGAWLGISALPVLIFVSSLIGLV AAIVMRVAKGRHFAFGPALTVSGWIIFTANDSVWRAVNWWLTHPVR
Source in vitro E.coli expression system
Gene Names pilD
Protein Names Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name(s): Prepilin peptidase N-methyltransferase EC= 2.1.1.-
Expression Region 1-286
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cleaves type-4 fimbrial leader sequence and methylates the N-terminal (generally Phe) residue.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase A24 family

Related Products

pilD Proteins

pilD Proteins for Neisseria gonorrhoeae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.