Recombinant UPF0060 membrane protein XOO1791(XOO1791)

Code CSB-CF702114XBB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5H1X6
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Sequence MNLAPTTLLLFAATALAELVGCYLPYLWLRNGGSVWLLLPTALRLASFVWLLSLHPDASG RVYAAYGGVYIASALGLWLWWVDGVTPTRWDLLGAVCCLFGMAIIMFAPRSA
Source in vitro E.coli expression system
Gene Names XOO1791
Protein Names Recommended name: UPF0060 membrane protein XOO1791
Expression Region 1-112
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0060 family
Database Links

KEGG: xoo:XOO1791

Related Products

XOO1791 Proteins

XOO1791 Proteins for Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.