Recombinant UPF0394 membrane protein XF_0765(XF_0765)

Code CSB-CF879208XBL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9PFB3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xylella fastidiosa (strain 9a5c)
Sequence MSLHVTLRFTVALAAGLLFGFGLALSEMINPIRVLSFLNVASGHWNPSLLFVLGSALAVA FPGMALQRRLKRPLLDECFHLPSKKVIDRRIVFGSAIFGTGWGLTGLCPGPAIASLSTGL GPVLLFVAAMAAGMIIHDRIVVRCLS
Source in vitro E.coli expression system
Gene Names XF_0765
Protein Names Recommended name: UPF0394 membrane protein XF_0765
Expression Region 1-146
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0394 family
Database Links

KEGG: xfa:XF_0765

STRING: 160492.XF0765

Related Products

XF_0765 Proteins

XF_0765 Proteins for Xylella fastidiosa (strain 9a5c)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.