Recombinant UPF0761 membrane protein XOO3615(XOO3615)

Code CSB-CF691881XBB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5GWQ2
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Sequence MSRVKKLHQWKERLRDRARTVSFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFTNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFICIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGVYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMAAFRYQPEAMRLPTGFEIYGLL RLLGRFRQARIHGEGLDEDRILALEPMLTDTLMQELLCELKRMRLLRRDERGQWLLARDL DLVPLAELYENCQLRVPIEDRPLPCRDDAYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP
Source in vitro E.coli expression system
Gene Names XOO3615
Protein Names Recommended name: UPF0761 membrane protein XOO3615
Expression Region 1-425
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: xoo:XOO3615

Related Products

XOO3615 Proteins

XOO3615 Proteins for Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.