Recombinant Uncharacterized ABC transporter ATP-binding protein Mb1304c (Mb1304c)

Code CSB-CF363619MVH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0A4W5
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Sequence MLLALLRQHIRPYRRLVAMLMMLQLVSTLASLYLPTVNAAIVDDGVAKGDTATIVRLGAV MLGVTGLQVLCAIGAVYLGSRTGAGFGRDLRSAMFEHIITFSERETARFGAPTLLTRSTN DVRQILFLVQMTATVLVTAPIMCVGGIIMAIHQEAALTWLLLVSVPILAVANYWIISHML PLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFAQANTALSNAALSAGNWQAL MLPVTTLTINASSVALIWFGGLRIDSGQMQVGSLIAFLSYFAQILMAVLMATMTLAVLPR ASVCAERITEVLSTPAALGNPDNPKFPTDGVTGVVRLAGATFTYPGADCPVLQDISLTAR PGTTTAIVGSTGSGKSTLVSLICRLYDVTAGAVLVDGIDVREYHTERLWSAIGLVPQRSY LFSGTVADNLRYGGGPDQVVTEQEMWEALRVAAADGFVQTDGLQTRVAQGGVNFSGGQRQ RLAIARAVIRRPAIYVFDDAFSALDVHTDAKVHASLRQVSGDATIIVVTQRISNAAQADQ VIVVDNGKIVGTGTHETLLADCPTYAEFAASQSLSATVGGVG
Source in vitro E.coli expression system
Gene Names BQ2027_MB1304C
Protein Names Recommended name: Uncharacterized ABC transporter ATP-binding protein Mb1304c
Expression Region 1-582
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, MsbA family

Related Products

BQ2027_MB1304C Proteins

BQ2027_MB1304C Proteins for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.