Recombinant Uncharacterized protein Mb0088 (Mb0088)

Code CSB-CF353764MVH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P64682
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Sequence MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALAAIPLLRGIRDNDRAL IAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLLITAGLTLTAFAITQPV VNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLDNGIAATAFLLTAGVPLI VELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD
Source in vitro E.coli expression system
Gene Names BQ2027_MB0088
Protein Names Recommended name: Uncharacterized protein Mb0088
Expression Region 1-220
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein

Related Products

BQ2027_MB0088 Proteins

BQ2027_MB0088 Proteins for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.