Recombinant Vi polysaccharide export inner-membrane protein vexB(vexB)

Code CSB-CF331749SWW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43109
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Salmonella typhi
Sequence MNILKNNSYYFMKLITVCELIILLMSRDIKTRYNGNLLNYMMVLAVPLVWISITVISFQY LNRSVPISTDDISFVIAGILPYLLFRYTITATMRTHSFSTSLAVVSQVKKRHVIFSLAAI EFVNAVIIYIIISLINFLIFSRWEAQKPFLIFEGMVIAWLLGLSFGYFCDALSERFPLVY KAVPVMLRPMFLISAVFYTANELPYSLLSIFSWNPLLHANEIVREGMFEGYHSLYLEPFY PLAFSATLFLAGLIFHLICDTENH
Source in vitro E.coli expression system
Gene Names vexB
Protein Names Recommended name: Vi polysaccharide export inner-membrane protein vexB
Expression Region 1-264
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May form an ATP-driven Vi polysaccharide export apparatus, in association with the VexA, VexC and VexD proteins.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ABC-2 integral membrane protein family
Database Links

KEGG: stt:t4347

STRING: 220341.STY4654

Related Products

vexB Proteins

vexB Proteins for Salmonella typhi

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.