Recombinant Vibrio cholerae serotype O1 Biopolymer transport protein exbB1(exbB1)

Code CSB-CF523797VEX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O52043
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Sequence MESLQQLQQQLGLMAWPLFICSALTVMLLAERLFQVLLSLTVGKGAIRHALQATSPKNPK QLAELTEHFASKRPVLYRGVAMLLAHHQFDKSLREDAAGIWLQEQRHQFNSGLRLLTLIG VISPLLGLLGTVLGLIEMFKGVAATTGSITPNVLADGLGVAMYTTAAGLLIAVPAVAGAQ LLSLWADRTMAKLEHTLNYVNLWLEGMTLHADASLTVVTPQEATTENL
Source in vitro E.coli expression system
Gene Names exbB1
Protein Names Recommended name: Biopolymer transport protein exbB1
Expression Region 1-228
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the TonB-dependent energy-dependent transport of various receptor-bound substrates. Protects ExbD from proteolytic degradation and functionally stabilizes TonB (By similarity).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ExbB/TolQ family
Database Links

KEGG: vch:VCA0911

STRING: 243277.VCA0911

Related Products

exbB1 Proteins

exbB1 Proteins for Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.