Recombinant Vibrio cholerae serotype O1 Electron transport complex protein RnfE(rnfE)

Code CSB-CF502145VEZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. C3LTR0
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio cholerae serotype O1 (strain M66-2)
Sequence MNENRTLMLNGMWNNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVR DYVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNDVLPAALDGFWMGLGMTSVLVVLGSLREIIGNGTLFDGADLLLGEWAKVLRIEVFHFD SAFLLALLPPGAFIGVGFLIAAKSVIDKQTAARQPKQQKQAIERARVTNV
Source in vitro E.coli expression system
Gene Names VCM66_0968
Protein Names Recommended name: Electron transport complex protein RnfE
Expression Region 1-230
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrDE/RnfAE family
Database Links

KEGG: vcm:VCM66_0968

Related Products

VCM66_0968 Proteins

VCM66_0968 Proteins for Vibrio cholerae serotype O1 (strain M66-2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.