Recombinant Vibrio cholerae serotype O1 Electron transport complex protein RnfE(rnfE)

Code CSB-CF888620VEX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9KT91
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Sequence MNENRTLMLNGMWNNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVR DYVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNDVLPAALDGFWMGLGMTSVLVVLGSLREIIGNGTLFDGADLLLGEWAKVLRIEVFHFD SAFLLALLPPGAFIGVGFLIAAKSVIDKQTAARQPKQQKQAIERARVTNV
Source in vitro E.coli expression system
Gene Names VC_1012
Protein Names Recommended name: Electron transport complex protein RnfE
Expression Region 1-230
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrDE/RnfAE family
Database Links

KEGG: vch:VC1012

STRING: 243277.VC1012

Related Products

VC_1012 Proteins

VC_1012 Proteins for Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.