Recombinant Vibrio cholerae serotype O1 UPF0126 membrane protein VC_2382(VC_2382)

Code CSB-CF881596VEX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9KPI5
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Sequence MHKSSNFSGLNLVKSAPICLLDIFHRCVDSETALDTSLLYLIDMFGTAVFAVSGVLLAGR LKMDPFGVMVLASVTAIGGGTIRDMALGATPVFWIKDTNYLWVIMITCALTMLLVRRPKR LAWWILPVCDAIGLAVFVGIGVEKALIYQDSALIAIIMGVITGCGGGIIRDVLAREIPMV LRSEVYATACIIGGIFHTTALAMGYSSSTALLSGVFSTLLIRLGAIRWHLSLPTFALTK
Source in vitro E.coli expression system
Gene Names VC_2382
Protein Names Recommended name: UPF0126 membrane protein VC_2382
Expression Region 1-239
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0126 family
Database Links

STRING: 243277.VC2382

Related Products

VC_2382 Proteins

VC_2382 Proteins for Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.