Recombinant Vibrio harveyi Probable amino-acid ABC transporter permease protein patM(patM)

Code CSB-CF346006VFD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P52625
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Vibrio harveyi (Beneckea harveyi)
Sequence MGFDFNYMLELLPILLKYLGTTMEMATWGLVFSLILSVILANIRVFKLPVLDQLSQLYIS FFRGTPLLVQLFLLYYGLPQIFPFMVGIDAFSAAVIGLTLHFAAYMAESIRAAIIGIDRS QMEASLSVGMTTTQAMRRVILPQATRVALPSLMNYFIDMIKSTSLAFTLGVAEIMAKAQM EASSSFRFFEAFLAVALIYWGVVVILTRVQIWAEAKLNKAYVR
Source in vitro E.coli expression system
Gene Names patM
Protein Names Recommended name: Probable amino-acid ABC transporter permease protein patM
Expression Region 1-223
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probably part of a binding-protein-dependent transport system for an amino acid. Probably responsible for the translocation of the substrate across the membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family, HisMQ subfamily

Related Products

patM Proteins

patM Proteins for Vibrio harveyi (Beneckea harveyi)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.