Recombinant Vibrio splendidus Electron transport complex protein RnfE(rnfE)

Code CSB-CF488308VFH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B7VLT3
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))
Sequence MSDHKTLIKNGMWANNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVSVSLVR NHVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNEVLPAAQDGFWMGLGMTSVLVVLGAMREIIGNGTLFDGADLLLGDWASVLRIQIFQFD NSFLLALLPPGAFIGVGFLIALKNIIDNQAKSRQPKQEKPVIERARVTNA
Source in vitro E.coli expression system
Gene Names VS_0972
Protein Names Recommended name: Electron transport complex protein RnfE
Expression Region 1-230
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrDE/RnfAE family
Database Links

KEGG: vsp:VS_0972

STRING: 575788.VS_0972

Related Products

VS_0972 Proteins

VS_0972 Proteins for Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.