Recombinant Vibrio splendidus Probable intracellular septation protein A (VS_1149)

Code CSB-CF490229VFH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B7VMM4
Storage Buffer Tris-based buffer,50% glycerol
Species Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))
Sequence MKQILDFIPLIIFFALYKMYDIYTATGALIVASAVQIILTYFIYKKVEKMQVITFLMVAV FGGMTIFLHDDNFIKWKVTIVYALFAIGLTVSHIMGKSAIKGMLGKEITLPDSIWGKINW AWTLFFTLCAILNVYVAFNLPLDVWVNFKVFGLLIATFAFTLLTGVYIYKHLPKDQHLPK DKHQQRDQETQNDTQQELSGKNTEEK
Source in vitro E.coli expression system
Gene Names VS_1149
Protein Names Recommended name: Probable intracellular septation protein A
Expression Region 1-206
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in cell division; probably involved in intracellular septation.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families YciB family
Database Links

KEGG: vsp:VS_1149

STRING: 575788.VS_1149

Related Products

VS_1149 Proteins

VS_1149 Proteins for Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.