Recombinant Vitis vinifera CASP-like protein VIT_01s0010g01870 (VIT_01s0010g01870)

Code CSB-CF415857VFQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7QBZ2
Storage Buffer Tris-based buffer,50% glycerol
Species Vitis vinifera (Grape)
Sequence MMGDKGEKECATASSPIELGCGEGDESGNKSSMRTVETLLRLVPVALCTVSLVVMLKNSQ TNDFGSLSYSDLGAFRYLVHANGICAGYSLLSAIFTAMPRPPTMSRAWTFFLLDQVLTYL ILAAGAVSTEVVYLAYKGDEAVTWSDACSSFGGFCQKTTASISITFVTVLCYAVLSLISS YKLFSKYDAPICFNGKGIEIAAFHS
Source in vitro E.coli expression system
Gene Names VIT_01s0010g01870
Protein Names Recommended name: CASP-like protein VIT_01s0010g01870
Expression Region 1-205
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: vvi:100249479

UniGene: Vvi.1372

Related Products

VIT_01s0010g01870 Proteins

VIT_01s0010g01870 Proteins for Vitis vinifera (Grape)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.