Recombinant Vitis vinifera CASP-like protein VIT_05s0020g01830 (VIT_05s0020g01830)

Code CSB-CF414517VFQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7NW79
Storage Buffer Tris-based buffer,50% glycerol
Species Vitis vinifera (Grape)
Sequence MSSVDTEKPAPPPLETEAPPPPPPPPPPPPPPPPPPAGYSALDVVLRILLLGSAVASVVV MVTSVQTKLIAVAGVPVLVSNKAKFQNSPAFIYFVAALSVVGLYSIITTLASFIFISKPS CSTKTILHLAIWDVLMLGLAASATGTAGGVAYVGLKGNSHVGWNKVCNTYDKFCRHVGGS IAVALFASILLVLLVWLSLFTLYSRIRK
Source in vitro E.coli expression system
Gene Names VIT_05s0020g01830
Protein Names Recommended name: CASP-like protein VIT_05s0020g01830
Expression Region 1-208
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: vvi:100246027

STRING: 29760.VIT_05s0020g01830.t01

UniGene: Vvi.1362

Related Products

VIT_05s0020g01830 Proteins

VIT_05s0020g01830 Proteins for Vitis vinifera (Grape)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.