Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF417840VFQ |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | A7QC16 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Vitis vinifera (Grape) |
| Sequence | MASKGEEKPELVGSKQGIVSVTKAKHDQIVLVLRVVAFLATASATIVMGLNQETKTLLVG TIGTTPIRATLKAKFQHTPAFVFFVVANGLASVYNLVMLGVDVFGRKLDCKGLRLVIISI LDMVIVAVVAAGASSAAFMAELGKNGNSHAKWNKICDKFESFCHQGGGALIPSFIALLLL FLISAISIITLHNQKLTSPHATTP |
| Source | in vitro E.coli expression system |
| Gene Names | VIT_10s0092g00220 |
| Protein Names | Recommended name: CASP-like protein VIT_10s0092g00220 |
| Expression Region | 1-204 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Casparian strip membrane proteins (CASP) family |
| Database Links |
KEGG: vvi:100247713 UniGene: Vvi.22079 |
VIT_10s0092g00220 Proteins for Vitis vinifera (Grape)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP417840VFQ1 CSB-EP417840VFQ1 CSB-BP417840VFQ1 CSB-MP417840VFQ1 |
Recombinant Vitis vinifera CASP-like protein VIT_10s0092g00220 (VIT_10s0092g00220),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Lysine-specific demethylase 5A(KDM5A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Thrombopoietin receptor(MPL),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Sulfotransferase family cytosolic 1B member 1(Sult1b1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human 60S acidic ribosomal protein P2(RPLP2)
Express system: E.coli
Species: Homo sapiens (Human)
