Recombinant Vitis vinifera CASP-like protein VIT_17s0000g00560 (VIT_17s0000g00560)

Code CSB-CF417838VFQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7PHN8
Storage Buffer Tris-based buffer,50% glycerol
Species Vitis vinifera (Grape)
Sequence MCFQFSILYTCYLAHFGVFPRKYLVMAGIEAKFQQNPPLGTHKLFLGAHICLRILTVTAT LTAAWMMITSKQTVEVYGIQVEAKYSYSSAFKFFSYANAIACGCSVLTLFPAFSLFYRGS TPMKFFFLFLHDLCMMSLVLAGCAAATAIGYVGRYGNNHAGWMAICDQFDEYCNRIRLSL MFSYLAFVFILMLTIMSANKSREIRV
Source in vitro E.coli expression system
Gene Names VIT_17s0000g00560
Protein Names Recommended name: CASP-like protein VIT_17s0000g00560
Expression Region 1-206
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

UniGene: Vvi.29057

Related Products

VIT_17s0000g00560 Proteins

VIT_17s0000g00560 Proteins for Vitis vinifera (Grape)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.