Recombinant Vitis vinifera Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880)

Code CSB-CF417265VFQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7PP95
Storage Buffer Tris-based buffer,50% glycerol
Species Vitis vinifera (Grape)
Sequence MSSGANATTIDVPETRAEAKGKAPLIAAPIVATTKATPHPNAGWKKGLAIFDFLLRLAAI AATLAAATTMGTTDETLPFFTQFFQFQASFDDLPAFMFFVVATAIASGYLALSLPFSLVS IFRPHAQGIRLLLIISDTVMLALTTAGAASATAIVYLAHNGDSSANWIAICQQFTDFCQS VSGAVVASFIAVVIFMLLVMMSALALRKH
Source in vitro E.coli expression system
Gene Names VIT_08s0007g02880
Protein Names Recommended name: Casparian strip membrane protein VIT_08s0007g02880
Expression Region 1-209
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: vvi:100242602

STRING: 29760.VIT_08s0007g02880.t01

UniGene: Vvi.27634

Related Products

VIT_08s0007g02880 Proteins

VIT_08s0007g02880 Proteins for Vitis vinifera (Grape)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.