Recombinant Xanthobacter autotrophicus UPF0060 membrane protein Xaut_1380 (Xaut_1380)

Code CSB-CF416343XAV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7IF35
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Sequence MTLPAFLFAALGEIAGCFAVWHVVRLGGSHWWLLPGIVSLAAFAYALTFVEAEAAGRAFA AYGGIYILSSLVWMWTVEGVRPDRWDATGAALCLAGAAVIVFGPRG
Source in vitro E.coli expression system
Gene Names Xaut_1380
Protein Names Recommended name: UPF0060 membrane protein Xaut_1380
Expression Region 1-106
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0060 family
Database Links

KEGG: xau:Xaut_1380

STRING: 78245.Xaut_1380

Related Products

Xaut_1380 Proteins

Xaut_1380 Proteins for Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.