Recombinant Xanthomonas axonopodis pv. citri UPF0761 membrane protein XAC0937(XAC0937)

Code CSB-CF854406XAD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8PNV2
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xanthomonas axonopodis pv. citri (strain 306)
Sequence MNKLHQWKERLRDRARTVSFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLS AFPAFNEWKDALTDFIFNNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHS IEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLA EFAWRLAPMAVEFVCIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQT YQRIYGALSALPILLLWIYLSWVSVLLGASLASSMSAFRYQPEAMRLPPGFEIYGLLRLL GRFSQARVHGDGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGQWLLARDLDVV PLAELYENCQLRVPIEDRPLPCRDDAFGQAAAAALEQLRQPLRSVLAQPVGDLYTHLPGD PP
Source in vitro E.coli expression system
Gene Names XAC0937
Protein Names Recommended name: UPF0761 membrane protein XAC0937
Expression Region 1-422
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: xac:XAC0937

STRING: 190486.XAC0937

Related Products

XAC0937 Proteins

XAC0937 Proteins for Xanthomonas axonopodis pv. citri (strain 306)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.