Recombinant Xanthomonas campestris pv. campestris Glucans biosynthesis glucosyltransferase H(opgH)

Code CSB-CF836920XAY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8P532
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Sequence MDGTVTLSPAPTDLPPVSSLDAGQPTLPPEAPLAMPEQSLREGSLQVRHQRTSPMGIGLR RFYLIGGTLTATAVAVWVMLSVLWPGGFSVLEGCLLGLFVLLFAWIAMSFASAVAGFITV VARAGRKLGIDPDAPLPSLHTRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEEQVYAELCDSVGGHGRIFYRRRADNAARKAGNVADWVRRFGGNYPQ MLILDADSVMTGDTIVRLVAGMEDNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLVRDRRWCQGNLQHAKVVGAKGLHWISRMHMMIGIGHY FTAPMWGMLMLVGIGIPLAGAGIDLAQGLPFSPARYWHGSSDGNAIWIFVCTMFVLLAPK LLGYIALLLNPRERRACGGAIRAALSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALIRSYGGLSVFGLFMGTLAYLVSPSLAAWMAPVIVGMVVSIPVVAV TSLRRTGLALRRAGIFCIPEELDPPKVLVRASELRRAAALEPSLI
Source in vitro E.coli expression system
Gene Names opgH
Protein Names Recommended name: Glucans biosynthesis glucosyltransferase H EC= 2.4.1.-
Expression Region 1-645
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 2 family, OpgH subfamily
Database Links

KEGG: xcc:XCC3515

STRING: 190485.XCC3515

Related Products

opgH Proteins

opgH Proteins for Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.