Recombinant Xanthomonas campestris pv. campestris Potassium-transporting ATPase C chain(kdpC)

Code CSB-CF844285XAY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8PCM0
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Sequence MSTSLPLRDDGAVRASFALALFVLLGLGLGYSLVATGITSALMPDQAHGSLLRADGRVIG SSLVAQPFADARYFQPRPSAAKYDPTAAAGSNQARSNPELLARIATARAEIAQRDGIAPD AVPGELLTQSGSGLDPHLSPAGAQVQLRRVAAARGWPEQRVAALLQAATEQPQFGLLGQP RINVLALNLALDRAGDGVPGTENGVEQQR
Source in vitro E.coli expression system
Gene Names kdpC
Protein Names Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain
Expression Region 1-209
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families KdpC family
Database Links

KEGG: xcc:XCC0704

STRING: 190485.XCC0704

Related Products

kdpC Proteins

kdpC Proteins for Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.