Recombinant Xanthomonas campestris pv. campestris Sensory/regulatory protein RpfC(rpfC)

Code CSB-CF366214XAY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0C0F6
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Sequence MKSPLPWLKRRLSGRADSEHAQNLIRIIITTLFISYLGWRYQHTHGDTLMATWLILVGEL LVSLGLMVAILLRPQVSHTRRLIGMLLDYTCTGAIMAIQGEPASPLYAVCMWVTIGNGLR YGSNYLRAATAMGSLCFLGAILISPYWKANPYLSWGLLLGLIAVPLYFDSLLRAMTRAVR EARHANQAKSRFLANMSHEFRTPLNGLSGMTEVLATTRLDAEQKECLNTIQASARSLLSL VEEVLDISAIEAGKIRIDRRDFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPDLLKG DTAHLRQVLLNLVGNAVKFTEHGHVLLRVTRVSGSAEDAVRLRFDVEDTGIGVPMDMRPR LFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGSIGFKENQPSGSVFWFELPMAIGEP LKSSTVRVPTGALVDAPEELESSNIIAFSNPFLRHRARVRSMRMLVADDHEANRMVLQRL LEKAGHKVLCVNGAEQVLDAMAEEDYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPV VVLSADVTPEAIRACEQAGARAFLAKPVVAAKLLDTLADLAVSTRQLATPATTVQVATSF EGVLDSSVLDELAALGMGEEFERQFVRQCLDDAQNCVGDIERDGTCSDWEQLRESAHALR GVASNLGLAQVASSGGELMRMADWQLQAEWRLRLSTLREQLKAGKDALDARVQGVKDGEC SPRSNE
Source in vitro E.coli expression system
Gene Names rpfC
Protein Names Recommended name: Sensory/regulatory protein RpfC EC= 2.7.13.3
Expression Region 1-726
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Member of the two-component regulatory system RpfG/RpfC, which is required for full virulence and for formation and dispersal of biofilms. Involved in sensing and responding to the diffusible signaling factor (DSF), which is essential for cell-cell signaling. RpfC is probably a sensor of environmental signals, including DSF, which is autophosphorylated at a histidine residue in response to the signal. Then, probably activates RpfG via a four-step phosphorelay. May also negatively regulate the production of DSF, independently of RpfG (By similarity).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Database Links

KEGG: xcc:XCC1856

STRING: 190485.XCC1856

Related Products

rpfC Proteins

rpfC Proteins for Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.