Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF314618XAF |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P0C0F7 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Xanthomonas campestris pv. campestris (strain 8004) |
| Sequence | MKSPLPWLKRRLSGRADSEHAQNLIRIIITTLFISYLGWRYQHTHGDTLMATWLILVGEL LVSLGLMVAILLRPQVSHTRRLIGMLLDYTCTGAIMAIQGEPASPLYAVCMWVTIGNGLR YGSNYLRAATAMGSLCFLGAILISPYWKANPYLSWGLLLGLIAVPLYFDSLLRAMTRAVR EARHANQAKSRFLANMSHEFRTPLNGLSGMTEVLATTRLDAEQKECLNTIQASARSLLSL VEEVLDISAIEAGKIRIDRRDFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPDLLKG DTAHLRQVLLNLVGNAVKFTEHGHVLLRVTRVSGSAEDAVRLRFDVEDTGIGVPMDMRPR LFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGSIGFKENQPSGSVFWFELPMAIGEP LKSSTVRVPTGALVDAPEELESSNIIAFSNPFLRHRARVRSMRMLVADDHEANRMVLQRL LEKAGHKVLCVNGAEQVLDAMAEEDYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPV VVLSADVTPEAIRACEQAGARAFLAKPVLAAKLLDTLADLAVSTRQLATPATTVQVATSF EGVLDSSVLDELAALGMGEEFERQFVRQCLDDAQNCVGDIERDGTCSDWEQLRESAHALR GVASNLGLAQVASSGGELMRMADWQLQAEWRLRLSTLREQLKAGKDALDARVQGVKDGEC SPRSNE |
| Source | in vitro E.coli expression system |
| Gene Names | rpfC |
| Protein Names | Recommended name: Sensory/regulatory protein RpfC EC= 2.7.13.3 |
| Expression Region | 1-726 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Member of the two-component regulatory system RpfG/RpfC, which is required for full virulence and for formation and dispersal of biofilms. Involved in sensing and responding to the diffusible signaling factor (DSF), which is essential for cell-cell signaling. RpfC is probably a sensor of environmental signals, including DSF, which is autophosphorylated at a histidine residue in response to the signal. Then, probably activates RpfG via a four-step phosphorelay. May also negatively regulate the production of DSF, independently of RpfG. |
| Subcellular Location | Cell inner membrane, Multi-pass membrane protein |
| Database Links |
KEGG: xcb:XC_2333 STRING: 314565.XC_2333 |
rpfC Proteins for Xanthomonas campestris pv. campestris (strain 8004)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP314618XAF1 CSB-EP314618XAF1 CSB-BP314618XAF1 CSB-MP314618XAF1 |
Recombinant Xanthomonas campestris pv. campestris Sensory/regulatory protein RpfC(rpfC) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Express system: E.coli
Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Elongation factor Tu, mitochondrial(TUFM)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Regulator of G-protein signaling 10(RGS10)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Sjoegren syndrome nuclear autoantigen 1(SSNA1)
Express system: E.coli
Species: Homo sapiens (Human)
