Code | CSB-CF314618XAF |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | rpfC |
Uniprot No. | P0C0F7 |
Species | Xanthomonas campestris pv. campestris (strain 8004) |
Expression Region | 1-726 |
Target Protein Sequence | MKSPLPWLKRRLSGRADSEHAQNLIRIIITTLFISYLGWRYQHTHGDTLMATWLILVGEL LVSLGLMVAILLRPQVSHTRRLIGMLLDYTCTGAIMAIQGEPASPLYAVCMWVTIGNGLR YGSNYLRAATAMGSLCFLGAILISPYWKANPYLSWGLLLGLIAVPLYFDSLLRAMTRAVR EARHANQAKSRFLANMSHEFRTPLNGLSGMTEVLATTRLDAEQKECLNTIQASARSLLSL VEEVLDISAIEAGKIRIDRRDFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPDLLKG DTAHLRQVLLNLVGNAVKFTEHGHVLLRVTRVSGSAEDAVRLRFDVEDTGIGVPMDMRPR LFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGSIGFKENQPSGSVFWFELPMAIGEP LKSSTVRVPTGALVDAPEELESSNIIAFSNPFLRHRARVRSMRMLVADDHEANRMVLQRL LEKAGHKVLCVNGAEQVLDAMAEEDYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPV VVLSADVTPEAIRACEQAGARAFLAKPVLAAKLLDTLADLAVSTRQLATPATTVQVATSF EGVLDSSVLDELAALGMGEEFERQFVRQCLDDAQNCVGDIERDGTCSDWEQLRESAHALR GVASNLGLAQVASSGGELMRMADWQLQAEWRLRLSTLREQLKAGKDALDARVQGVKDGEC SPRSNE |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Member of the two-component regulatory system RpfG/RpfC, which is required for full virulence and for formation and dispersal of biofilms. Involved in sensing and responding to the diffusible signaling factor (DSF), which is essential for cell-cell signaling. RpfC is probably a sensor of environmental signals, including DSF, which is autophosphorylated at a histidine residue in response to the signal. Then, probably activates RpfG via a four-step phosphorelay. May also negatively regulate the production of DSF, independently of RpfG. |
Subcellular Location | Cell inner membrane, Multi-pass membrane protein |
Database Links |
KEGG: xcb:XC_2333 STRING: 314565.XC_2333 |
Recombinant Human Bifunctional Epoxide hydrolase 2(EPHX2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Eukaryotic translation initiation factor 3 subunit E(EIF3E)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related C3 botulinum toxin substrate 3(RAC3)
Express system: E.coli
Species: Homo sapiens (Human)