Recombinant Xanthomonas campestris pv. campestris UPF0761 membrane protein xcc-b100_3490 (xcc-b100_3490)

Code CSB-CF532320XAZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B0RUB3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xanthomonas campestris pv. campestris (strain B100)
Sequence MSRVNTMHQWKERLRDRARTASFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFNNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFVCIVLIYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMSAFRYQPEAMRLPPGFEIYGLL RLLGRFRQARLHGNGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERSNWLLARDL DVVPLAELYESCQLRVPVEDRPLPCRDDPYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP
Source in vitro E.coli expression system
Gene Names xcc-b100_3490
Protein Names Recommended name: UPF0761 membrane protein xcc-b100_3490
Expression Region 1-425
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: xca:xcc-b100_3490

Related Products

xcc-b100_3490 Proteins

xcc-b100_3490 Proteins for Xanthomonas campestris pv. campestris (strain B100)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.