Recombinant Xanthomonas campestris pv. vesicatoria Glucans biosynthesis glucosyltransferase H(opgH)

Code CSB-CF664224XAAC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3BXV7
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas campestris pv. vesicatoria (strain 85-10)
Sequence MDGTVTPSPTTTAMPPVSALDAGTPTLPPEAPLAMPEQNLREGSLQVRHQRTSPPGIGVR RFYLIGGTFATTAIAVWVMLSVLWPDGISVLEGCLLGLFVLLFAWIAMSFASAVAGFVTV VARAGRKLGIDPEQPLPTLRSRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEELVYNELCDRVDGHGRIFYRRRADNAARKAGNVADWVRRFGGSYPQ MLILDADSVMTGDTIVRLVAGMENNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKVVSAKGLHWISRMHMLIGIGHY FTAPMWGLLMLIGIGIPLAGGGIDLAGDLPFSPARYWHGSSQGNAIWIFICTMFVLLAPK LLGYIALLLNPRELRACGGAFRAAVSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALFRSYGGLTVFGLFMGAVAYAVSPALAAWMGPVIVGMALSIPVVAL TSLRRTGMALRRAGIFCIPEELDPPKVLVRASELRRAAALEPSLI
Source in vitro E.coli expression system
Gene Names opgH
Protein Names Recommended name: Glucans biosynthesis glucosyltransferase H EC= 2.4.1.-
Expression Region 1-645
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 2 family, OpgH subfamily
Database Links

KEGG: xcv:XCV0675

STRING: 316273.XCV0675

Related Products

opgH Proteins

opgH Proteins for Xanthomonas campestris pv. vesicatoria (strain 85-10)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.