Recombinant Xanthomonas oryzae pv. oryzae UPF0060 membrane protein XOO1694(XOO1694)

Code CSB-CF651585XAAB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2P4S8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Sequence MNLAPTTLLLFAATALAELVGCYLPYLWLRNGGSVWLLLPTALRLASFVWLLSLHPDASG RVYAAYGGVYIASALGLWLWWVDGVTPTRWDLLGAVCCLFGMAIIMFAPRSA
Source in vitro E.coli expression system
Gene Names XOO1694
Protein Names Recommended name: UPF0060 membrane protein XOO1694
Expression Region 1-112
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0060 family
Database Links

KEGG: xom:XOO1694

Related Products

XOO1694 Proteins

XOO1694 Proteins for Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.