Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 2-B(mogat2-b)

Code CSB-CF705784XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5M7F4
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MWIHFAPLRIPFSRRLQTVAVLQWAVSFLAMAQCCIALYILLLFSRYWFLALLYGVWLYL DWDTPSKGGRRSNWVRSWIVWKYFAEYFPIKLLCTAPLDPKYNYIMGFHPHGVLVVGAFG NFCTEGTGFSRLFPGLTPHLLMLPAWFRVPFFREYIMSGSLVSSDRSSAHYLLSQKSGGQ ALVIAVGGPPEALDAKPGELTLQLLNRTGFIKMALTHGAHLVPVLSFGENDLYNQVNNPR GSLLRTTQEKLQKVLGIALPLFHGRGVFQYSWGLLPHRRPIYTVVGSPIPVAKTPCPTQE QISSLHALYVAKLRELYTTHKGNYGIPRDRSLVLC
Source in vitro E.coli expression system
Gene Names mogat2-b
Protein Names Recommended name: 2-acylglycerol O-acyltransferase 2-B EC= 2.3.1.22 Alternative name(s): Acyl-CoA:monoacylglycerol acyltransferase 2-B Short name= MGAT2-B Monoacylglycerol O-acyltransferase 2-B
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Database Links

KEGG: xla:496214

UniGene: Xl.47003

Related Products

mogat2-b Proteins

mogat2-b Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.