Recombinant Xenopus laevis Abhydrolase domain-containing protein 13(abhd13)

Code CSB-CF753719XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6IRP4
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MEKHWVLWSCAERWLLALASWSWGLCRICLLPLILTFNMYGGVILLLLIFVSIAGILFKF QDVLLYFPDQPSSSRLYIPMPTGIPHENIFIKTKDNIRLNLILLRYTGDNSSFSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSDGEPSEEGLYMDSEAVLDYVMTRP DIDKTKIILFGRSLGGAVAIHLASENAHRICALVLENTFLSIPHMASTLFSVLPMRYLPL WCYKNKFLSYRKIVQCRMPSLFISGLSDQLIPPFMMKQLYELSPSRTKRLAIFPDGTHND TWQCQGYFTALEQFIKELNSNHCPEANAKTSNVTII
Source in vitro E.coli expression system
Gene Names abhd13
Protein Names Recommended name: Abhydrolase domain-containing protein 13 EC= 3.-.-.-
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Serine esterase family
Database Links

KEGG: xla:432053

UniGene: Xl.76073

Related Products

abhd13 Proteins

abhd13 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.