Recombinant Xenopus laevis ER lumen protein retaining receptor 1-A(kdelr1-a)

Code CSB-CF764763XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6PAB8
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MNIFRFLGDISHLSAIFILLLKIWKSRSCAGISGKSQLLFAIVFTARYLDLFTNYISFYN TSMKVVYVASSYATVWMIYSKFKATYDGNHDTFRVEFLIVPTAILAFLVNHDFTPLEIFW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGIYRTLYLFNWIWRYQFEGFFDLIA IVAGLVQTVLYCDFFYLYVTKVLKGKKLSLPA
Source in vitro E.coli expression system
Gene Names kdelr1-a
Protein Names Recommended name: ER lumen protein retaining receptor 1-A Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1-A Short name= KDEL receptor 1-A
Expression Region 1-212
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum resident proteins via vesicular recycling. This receptor recognizes the C-terminal K-D-E-L motif. COPI-coated transport intermediates, either in the form of round vesicles or as tubular processes, mediate retrograde traffic of the KDEL receptor-ligand complexes. Also required for normal vesicular traffic through the Golgi (By similarity).
Subcellular Location Cytoplasmic vesicle, COPI-coated vesicle membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane
Protein Families ERD2 family
Database Links

KEGG: xla:398905

UniGene: Xl.83179

Related Products

kdelr1-a Proteins

kdelr1-a Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.