Recombinant Xenopus laevis Hyaluronan synthase 1 (has1)

Code CSB-CF010139XBE
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
has1
Uniprot No.
Alternative Names
has1; Hyaluronan synthase 1; DG42 protein; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1; xHAS1
Species
Xenopus laevis (African clawed frog)
Expression Region
1-588
Target Protein Sequence
MKEKAAETMEIPEGIPKDLEPKHPTLWRIIYYSFGVVLLATITAAYVAEFQVLKHEAILF SLGLYGLAMLLHLMMQSLFAFLEIRRVNKSELPCSFKKTVALTIAGYQENPEYLIKCLES CKYVKYPKDKLKIILVIDGNTEDDAYMMEMFKDVFHGEDVGTYVWKGNYHTVKKPEETNK GSCPEVSKPLNEDEGINMVEELVRNKRCVCIMQQWGGKREVMYTAFQAIGTSVDYVQVCD SDTKLDELATVEMVKVLESNDMYGAVGGDVRILNPYDSFISFMSSLRYWMAFNVERACQS YFDCVSCISGPLGMYRNNILQVFLEAWYRQKFLGTYCTLGDDRHLTNRVLSMGYRTKYTH KSRAFSETPSLYLRWLNQQTRWTKSYFREWLYNAQWWHKHHIWMTYESVVSFIFPFFITA TVIRLIYAGTIWNVVWLLLCIQIMSLFKSIYACWLRGNFIMLLMSLYSMLYMTGLLPSKY FALLTLNKTGWGTSGRKKIVGNYMPILPLSIWAAVLCGGVGYSIYMDCQNDWSTPEKQKE MYHLLYGCVGYVMYWVIMAVMYWVWVKRCCRKRSQTVTLVHDIPDMCV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. Also able to catalyze the synthesis of chito-oligosaccharide depending on the substrate.
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
NodC/HAS family
Tissue Specificity
Expression moves as a gradient through the embryo. The mRNA is first expressed in the animal region of the blastula, and by early gastrula is found everywhere except in the outer layer of the dorsal blastopore lip. By mid-gastrula, protein is present in t
Database Links

KEGG: xla:379383

UniGene: Xl.4517

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1