Recombinant Xenopus laevis Hyaluronan synthase 1(has1)

Code CSB-CF010139XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P13563
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xenopus laevis (African clawed frog)
Sequence MKEKAAETMEIPEGIPKDLEPKHPTLWRIIYYSFGVVLLATITAAYVAEFQVLKHEAILF SLGLYGLAMLLHLMMQSLFAFLEIRRVNKSELPCSFKKTVALTIAGYQENPEYLIKCLES CKYVKYPKDKLKIILVIDGNTEDDAYMMEMFKDVFHGEDVGTYVWKGNYHTVKKPEETNK GSCPEVSKPLNEDEGINMVEELVRNKRCVCIMQQWGGKREVMYTAFQAIGTSVDYVQVCD SDTKLDELATVEMVKVLESNDMYGAVGGDVRILNPYDSFISFMSSLRYWMAFNVERACQS YFDCVSCISGPLGMYRNNILQVFLEAWYRQKFLGTYCTLGDDRHLTNRVLSMGYRTKYTH KSRAFSETPSLYLRWLNQQTRWTKSYFREWLYNAQWWHKHHIWMTYESVVSFIFPFFITA TVIRLIYAGTIWNVVWLLLCIQIMSLFKSIYACWLRGNFIMLLMSLYSMLYMTGLLPSKY FALLTLNKTGWGTSGRKKIVGNYMPILPLSIWAAVLCGGVGYSIYMDCQNDWSTPEKQKE MYHLLYGCVGYVMYWVIMAVMYWVWVKRCCRKRSQTVTLVHDIPDMCV
Source in vitro E.coli expression system
Gene Names has1
Protein Names Recommended name: Hyaluronan synthase 1 EC= 2.4.1.212 Alternative name(s): DG42 protein Hyaluronate synthase 1 Hyaluronic acid synthase 1 Short name= HA synthase 1 Short name= xHAS1
Expression Region 1-588
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. Also able to catalyze the synthesis of chito-oligosaccharide depending on the substrate.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families NodC/HAS family
Tissue Specificity Expression moves as a gradient through the embryo. The mRNA is first expressed in the animal region of the blastula, and by early gastrula is found everywhere except in the outer layer of the dorsal blastopore lip. By mid-gastrula, protein is present in t
Database Links

KEGG: xla:379383

UniGene: Xl.4517

Related Products

has1 Proteins

has1 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.