Recombinant Xenopus laevis Hyaluronan synthase-related protein(has-rs)

Code CSB-CF524498XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O57428
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MENTTDPENIPVSKPKYPTIRRILSQTFRILLLFSITTAYVLGYQALCHQGLLITFGLYG AAMLLHLLMQGIFANLEIRRIEKRDGVCSFKKTVALTITGYQENPDYLRQCLESCKGMKY PKDKLKIILVIDGNNEEDVYMMEIFKEVFHGEDVGTYVWQENYHTWNIPSEESEDSSSEI SSFPWKNEGIQMVEELVRTKRCVCIMQQWGGKREVMYTAFRALGTSVDFILVCNSDIKLD KMATVELVKVLEDDDKNGAVGGDVRVWNRHDSFISFMSSLRYWMVFNMEIACQSYFDSVT YIRGSLGMYRNDILQAFLEFWYNKTFLGTRCPIGDDRFLTNRVLSMGYRTKYSHKSCAYA PCQYLRWLNQQTPWARSYFRMWFCNAQWWHQHHIWMTYESATGIFFPFFVTAVLIRLMYS SSLCNIVWLFLCIQIMSLLLSLYASWQSKKLSMVLMSLYSTLYIIWLLPCQLVALLTIAK SDWGTSGRKKVVNNYVPLFSLSIWAAVLLGGLCYSMYIGCRKDWSKPQANRELYHLLYGC AGYMAYWVLMTVIYCVSGSCCKMRSQAVPQTHDITSLSVSLLV
Source in vitro E.coli expression system
Gene Names has-rs
Protein Names Recommended name: Hyaluronan synthase-related protein Alternative name(s): Hyaluronan synthase-related sequence Short name= xHAS-rs
Expression Region 1-583
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families NodC/HAS family
Database Links

KEGG: xla:398074

UniGene: Xl.23252

Related Products

has-rs Proteins

has-rs Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.