Recombinant Xenopus laevis Phosphatidate phosphatase PPAPDC1B(ppapdc1b)

Code CSB-CF746808XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6GQ62
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MWLYRNPYVVSDRIPTNSMFLISFLTPLSVVALARLFWKADGTDSREAGLAASLSLALNG IFTNTVKLIVGRPRPDFLFRCFPDGQESPGLHCTGDPELVIEGRKSFPSGHSSFAFAGLG FTALYLAGKLRCFSPCGRGHSWRLCASLIPLLCAIAIALSRTCDYKHHWQDVVVGAFIGL FFAFLCYRQYYPSLVERDCHQPYRNKGRMSGAQERKLSTPGYSLDV
Source in vitro E.coli expression system
Gene Names plpp5
Protein Names Recommended name: Phosphatidate phosphatase PPAPDC1B EC= 3.1.3.4 Alternative name(s): Phosphatidic acid phosphatase type 2 domain-containing protein 1B
Expression Region 1-226
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PA-phosphatase related phosphoesterase family
Database Links

KEGG: xla:443950

UniGene: Xl.32558

Related Products

plpp5 Proteins

plpp5 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.