Recombinant Xenopus laevis RDS/peripherin-like protein xRDS36(rds36)

Code CSB-CF516638XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O42582
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MVLFKAKFSFQRRVKLAQTLWLLSWLSVLVGCLTFGMGIFLKVQLWIHNEVMDNTTAHAV PNTVITAGLVGILLGYFAGKISQASMDLTKYQRWKSFMMPFFFLAILSCIVCLAALVLSV ALRGTLEESLKIGLRNAIRFYKDTDTPGRCYQKRSMDKLEMDFQCCGNNHPKDWFEVQWI SNRYLDFSSKEVKDRIKSSVDGRYLMDSVPFTCCNPSSPRPCIQIEITNNSAHYSYNFQG DDVNIWVRGCREALLGYYTGIMATNGAAVTLSFLLQASVLVSLRYVQTSMDKIRDPDDVE ADTEGFLLEKGVMETVNSSLEKIKDLFKSNQVETAEGGGEGAAGS
Source in vitro E.coli expression system
Gene Names rds36
Protein Names Recommended name: RDS/peripherin-like protein xRDS36
Expression Region 1-345
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PRPH2/ROM1 family
Tissue Specificity Rod specific.
Database Links

KEGG: xla:398001

UniGene: Xl.191

Related Products

rds36 Proteins

rds36 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.