Recombinant Xenopus laevis RING finger protein 121(rnf121)

Code CSB-CF019824XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6DD32
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MAAVLEVEIGGEAVREAAGEEMDLSELAPEERWRVEHARMHAKHRGHEAMHAEMVLILIA TLVVAQLLLVQWKQRHQRSYNMVTLFQMWIVPVYFTVKLHWWRFLGIWIVFSIITAYITY KATRKPLLQTTPRLVYKWFLLLYKMSYATGIVGYIAVMFTLFGLNLLFRIKPEDAMDFGI SLLFYGLYYGVLGRDFAELCADYMASTIGFYSASGMPTKHLSDSVCAVCGQQIFVDVNEE GIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLL DWLRYLVAWQPVIIGLVQGINYCLGLE
Source in vitro E.coli expression system
Gene Names rnf121
Protein Names Recommended name: RING finger protein 121
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families RNF121 family
Database Links

KEGG: xla:446774

UniGene: Xl.6422

Related Products

rnf121 Proteins

rnf121 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.