Recombinant Xenopus laevis Sugar transporter SWEET1(slc50a1)

Code CSB-CF740655XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6NTJ7
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MDWMWLLSGACIVFTLGMFSSGLSDLRVMVAQRSVENIQYLPFLTTDLNNLGWFYYGYLK GDGTLMIVNVIGASLQSLYMGAYLLYSPERRYVGSQVLVSLGVLLLGYCYFTLWILDLNS RLNQLGLFCSVFTISMYLSPLADLAQIIRSKSTKCLSFPLTVATFLTSSSWVLYGLVQSD LYITVPNFPGIVTSLVRFWLFSQFPPDPPTYRLLQA
Source in vitro E.coli expression system
Gene Names slc50a1
Protein Names Recommended name: Sugar transporter SWEET1 Alternative name(s): Solute carrier family 50 member 1
Expression Region 1-216
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates sugar transport across membranes.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families SWEET sugar transporter family
Database Links

KEGG: xla:414448

UniGene: Xl.45627

Related Products

slc50a1 Proteins

slc50a1 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.