Recombinant Xenopus laevis Transmembrane protein 129(tmem129)

Code CSB-CF023696XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6IR55
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence EFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSSATLLAHSLLPMGYFIGMCFAAPEKELY NVHKAADGWKVFVLMAVLLPIATSILAFYWSQKRWSNHPLAKTLAHHALPQSSWRAVASS INTEFRRIDKFATGAPSARVIVTDTWVMKVTTYKVDVAQQQDIHLTVTDSRQHELSPDSN TPVQFITIRVASINPRVKPFDIRLNSTEYGELREKLHAPIRNAANIVIHQTLGDMFLDTF RSLVEANHTYEISSNQELEPCIGCMQTNANIKLVKYCQEANEGECQQCYCRPMWCLTCMG KWFASRQDQQHPETWLSSQVPCPTCRAKFCIVDVCIVR
Source in vitro E.coli expression system
Gene Names tmem129
Protein Names Recommended name: Transmembrane protein 129
Expression Region 25-362
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function E3 ubiquitin-protein ligase involved in ER-associated protein degradation, preferentially associates with the E2 enzyme UBE2J2.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families TMEM129 family
Database Links

KEGG: xla:432097

UniGene: Xl.5958

Related Products

tmem129 Proteins

tmem129 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.