Recombinant Xenopus laevis Vang-like protein 2-B(vangl2-b)

Code CSB-CF841936XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q90Z05
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus laevis (African clawed frog)
Sequence MDNDSQYSGYSYKSGQSRSSRKHRDRRERHRSKSREGSRGDKSVTIQAPGEPLLDNESTR GEDRDDNWGETTTVVTGTSEHSISHDDITRITKDMEDSAKLDCSRHLGVVIAGALALLSF LTPIAFMLLPQILWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFV FRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELR QLQPQFTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK KMSGFKVYSLGEENNTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRKARLV VAVEEAFTHIKRLQDEDPKNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFEL KRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV
Source in vitro E.coli expression system
Gene Names vangl2-b
Protein Names Recommended name: Vang-like protein 2-B Alternative name(s): Protein strabismus-B Van Gogh-like protein 2-B Xstrabismus-B Short name= Xstbm-B
Expression Region 1-521
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in non-canonical Wnt/planar cell polarity (PCP) signaling; can recruite dvl/dsh and prickle from the cytoplasm to the plasma membrane. Acts in a PCP complex to regulate the polarized assembly of fibronectrin on the surface of the mesoderm during gastrulation. Regulates convergent extension in both dorsal mesoderm and neural tissue without affecting cell fate. Regulates neural fold closure during neurulation
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Vang family
Tissue Specificity During gastrulation, broadly expressed in the dorsal region in both mesodermal and neural tissues. From the neurula stages, expressed throughout the neural tube. In tailbud stages, expression declines in the anterior notochord but remains strong in the po
Database Links

KEGG: xla:399177

UniGene: Xl.5981

Related Products

vangl2-b Proteins

vangl2-b Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.