Recombinant Xenopus tropicalis 2-acylglycerol O-acyltransferase 2(mogat2)

Code CSB-CF686674XBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5M8H5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Sequence MWIHFAPLKIPFSRRLQTGAVLQWAVSFLAMAQCCIALYILLLFSRYWYLAVLYGVWLYI DWDTPSKGGRRSNWVRSWTVWKYFAEYFPIKLLCTAPLDPKYNYIMGFHPHGVLVVGAFG NFCTEGTGFSRLFPGLTPHLLMLPAWFRVPFFREYIMSGSLVSSDRSSAHHLLSQKSGGQ ALVIAVGGPPEALDAKPGELTLQLLNRTGFIKMALTHGAHLVPVLSFGENDLYNQVNNPR GSLLRATQEKLQKIFGIALPLFHGRGVFQYSWGLLPHRRPIYTVVGSPIHVTKTPCPTRE QISSLHSLYIAKLRDLFETHKGNYGIPEDRSLVLC
Source in vitro E.coli expression system
Gene Names mogat2
Protein Names Recommended name: 2-acylglycerol O-acyltransferase 2 EC= 2.3.1.22 Alternative name(s): Acyl-CoA:monoacylglycerol acyltransferase 2 Short name= MGAT2 Monoacylglycerol O-acyltransferase 2
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Database Links

KEGG: xtr:496754

STRING: 8364.ENSXETP00000008697

UniGene: Str.83172

Related Products

mogat2 Proteins

mogat2 Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.