Recombinant Xenopus tropicalis Post-GPI attachment to proteins factor 3(pgap3)

Code CSB-CF613145XBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q0VFE3
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Sequence DREPVYRDCVTLCERNNCTGSRLTDFRAEQPLYMRVTGWTCLDDCRYQCMWYTVSLYLKE GHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLMLLRYRSSVPSSCQMYRTCLAFS MVSVNAWFWSTIFHTRDTALTEKMDYFCASSVILHSIYLCCMRTFGLQYPSIANGFGAFL VLLFACHVSYLTLGRFDYSYNMAANTGFGVLNLMWWLAWCFRRRFHQPYLWKCVLVVISL QSLALLELLDFPPVMWILDAHALWHFSTVPLHFLFYSFLKDDSLYLLKINHDDIPKLD
Source in vitro E.coli expression system
Gene Names pgap3
Protein Names Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): PER1-like domain-containing protein 1
Expression Region 19-316
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the lipid remodeling steps of GPI-anchor maturation.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families PGAP3 family
Database Links

KEGG: xtr:779696

UniGene: Str.39659

Related Products

pgap3 Proteins

pgap3 Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.