Recombinant Xenopus tropicalis RING finger protein 121(rnf121)

Code CSB-CF019824XBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6P360
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Sequence MAAVLEVEIGGEAVREAAGEEVDLSELAPEERWRVEHARMHAKHRGHEAMHAEMVLILIA TLVVAQLLLVQWKQRHQRSYNMVTLFQMWIVPVYFTVKLHWWRFLGIWFLFSIVTAFVTY KATRKPLVQTTPRLVYKWFLLLYKMSYATGIVGYIAVMFTLFGLNLLFRIKPEDAMDFGI SLLFYGLYYGVLGRDFAEMCADYMASTIGFYSASGMPTKHLSDSVCAVCGQQIFVDVNEE GIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLL DWLRYLVAWQPVIIGLVQGINYCLGLE
Source in vitro E.coli expression system
Gene Names rnf121
Protein Names Recommended name: RING finger protein 121
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families RNF121 family
Database Links

KEGG: xtr:394908

STRING: 8364.ENSXETP00000051634

UniGene: Str.6646

Related Products

rnf121 Proteins

rnf121 Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.