Recombinant Yarrowia lipolytica pH-response regulator protein palI/RIM9(RIM9)

Code CSB-CF770368YAP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7Z8R5
Storage Buffer Tris-based buffer,50% glycerol
Species Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Sequence MGLRMKSATGLLVILLIAFALQLVAVLSVPVTKTISLGSYQDHKFGVFGYCNVKDGTCSP AGVGYNLVDSDNAGFSLPSNARHTLSNLLIVHPIATGFTLILTVLAMLAHIQGPASSSRY LLFCLVFSLPTFLLVLLSFLVDILLFVPHLDWGGWIVLAATILVAISGVVLCVMRRTLSS KKAMKKHQLDTTNELSAFSSHKHLNSFTYSSKENVPQFSELRYETSHDTSKDEEVLPLTS HVYEEPGHHVGDTSYASQGTNNSRVNLLTSEEPQAPKRESPFKDQRQDRYTPDRYGPSPD RYDQGGPGRPPNGSRGVPPRRPSNGPTPPGQGPSPTGAYGRNNNPNYNGGYNNRLPRPRG PPGSNNSSPFLGARNGPGLTPPHNLQTATTGPMQLPAGTYLPGEEPANSPDTYGPGVIPI PEIRRESKVPGASPTPPPVSGNSPPTETSESGVSRPYRGNYSRRGSEASAQTPPNAQPNP PPGGAQNYEYVPARQQWNLTTEESNATAPAPGPQPLQRNHSYDTYNPYRSETPSAPGSRA QSQGTDDNLGTLHQPVPTTVTPSNSGALNNKDSPWYSPPVDEQFRNSFIPDAPVSPSESI SSNFTSVSQRGINPRYFGADGPPGGLHQGAPPPPHMRGPPPHMGMGGPNMGGHNMGGHNM GGPPPNMGPRPPYGGGGPGHGNKHDLLLSGNPDSQFQPQTRRKPGRGGRPGMSPASLMGR DTGPYSMR
Source in vitro E.coli expression system
Gene Names RIM9
Protein Names Recommended name: pH-response regulator protein palI/RIM9
Expression Region 1-728
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalI/RIM9 family
Database Links

KEGG: yli:YALI0E33627g

STRING: 4952.XP_504739.1

Related Products

RIM9 Proteins

RIM9 Proteins for Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.