Recombinant Acinetobacter baumannii Serine/threonine transporter sstT(sstT)

Product Type Recombinant Protein
Uniprot No. B0VR07
Species Acinetobacter baumannii (strain SDF)
Gene Names sstT
Protein Names Recommended name: Serine/threonine transporter sstT Alternative name(s): Na(+)/serine-threonine symporter
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Involved in the import of serine and threonine into the cell, with the concomitant import of sodium (symport system).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
Database Links

KEGG: abm:ABSDF2098

Product Details for Different Expression Systems

Product Name Recombinant Acinetobacter baumannii Serine/threonine transporter sstT(sstT),Yeast
Code CSB-YP535212AWQ
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLEFFSRLSLVTKIIIAIILGIGVALLFPTVTPYLSLFGELFIKALKSVAPILAFVLVLS SIANFQVGHSANLRPVLLLYVVGMLLAAFSAVIASLSFPSTLYLNTVSHNNLQAPGSLAD ILKNLLLSFIANPVQAISEANFIGILAWAIGLGLAMRHSSDTTKQVMQDVSHAVSAIIHK VIAFAPVGIFGLVAVTFADAGLATLESYAQLLAVLLGTMLFVALVINPILVGLTIRGNPY PLVFKCLKESGITAFFTRSSAANIPVNLDLAERLGVNPSTASVSIPLGATVNLAGAAVTI TVLTLATVHTLGIHVDLATMIILSVVATVSACGASGVAGGSLLLIPVACSLFGISSEIAM QVVAVGMIISVLQDSTETALNSSTDVLFTAAVDIRSRQNS
Expression Region 1-400
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Acinetobacter baumannii Serine/threonine transporter sstT(sstT),E.coli
Code CSB-EP535212AWQ
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLEFFSRLSLVTKIIIAIILGIGVALLFPTVTPYLSLFGELFIKALKSVAPILAFVLVLS SIANFQVGHSANLRPVLLLYVVGMLLAAFSAVIASLSFPSTLYLNTVSHNNLQAPGSLAD ILKNLLLSFIANPVQAISEANFIGILAWAIGLGLAMRHSSDTTKQVMQDVSHAVSAIIHK VIAFAPVGIFGLVAVTFADAGLATLESYAQLLAVLLGTMLFVALVINPILVGLTIRGNPY PLVFKCLKESGITAFFTRSSAANIPVNLDLAERLGVNPSTASVSIPLGATVNLAGAAVTI TVLTLATVHTLGIHVDLATMIILSVVATVSACGASGVAGGSLLLIPVACSLFGISSEIAM QVVAVGMIISVLQDSTETALNSSTDVLFTAAVDIRSRQNS
Expression Region 1-400
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Acinetobacter baumannii Serine/threonine transporter sstT(sstT),Baculovirus
Code CSB-BP535212AWQ
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLEFFSRLSLVTKIIIAIILGIGVALLFPTVTPYLSLFGELFIKALKSVAPILAFVLVLS SIANFQVGHSANLRPVLLLYVVGMLLAAFSAVIASLSFPSTLYLNTVSHNNLQAPGSLAD ILKNLLLSFIANPVQAISEANFIGILAWAIGLGLAMRHSSDTTKQVMQDVSHAVSAIIHK VIAFAPVGIFGLVAVTFADAGLATLESYAQLLAVLLGTMLFVALVINPILVGLTIRGNPY PLVFKCLKESGITAFFTRSSAANIPVNLDLAERLGVNPSTASVSIPLGATVNLAGAAVTI TVLTLATVHTLGIHVDLATMIILSVVATVSACGASGVAGGSLLLIPVACSLFGISSEIAM QVVAVGMIISVLQDSTETALNSSTDVLFTAAVDIRSRQNS
Expression Region 1-400
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Acinetobacter baumannii Serine/threonine transporter sstT(sstT),Mammalian cell
Code CSB-MP535212AWQ
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MLEFFSRLSLVTKIIIAIILGIGVALLFPTVTPYLSLFGELFIKALKSVAPILAFVLVLS SIANFQVGHSANLRPVLLLYVVGMLLAAFSAVIASLSFPSTLYLNTVSHNNLQAPGSLAD ILKNLLLSFIANPVQAISEANFIGILAWAIGLGLAMRHSSDTTKQVMQDVSHAVSAIIHK VIAFAPVGIFGLVAVTFADAGLATLESYAQLLAVLLGTMLFVALVINPILVGLTIRGNPY PLVFKCLKESGITAFFTRSSAANIPVNLDLAERLGVNPSTASVSIPLGATVNLAGAAVTI TVLTLATVHTLGIHVDLATMIILSVVATVSACGASGVAGGSLLLIPVACSLFGISSEIAM QVVAVGMIISVLQDSTETALNSSTDVLFTAAVDIRSRQNS
Expression Region 1-400
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.