Recombinant Bothrops jararaca Zinc metalloproteinase/disintegrin

Product Type Recombinant Protein
Uniprot No. Q0NZX6
Species Bothrops jararaca (Jararaca) (Bothrops jajaraca)
Protein Names Recommended name: Zinc metalloproteinase/disintegrin Cleaved into the following 2 chains: 1. Metalloproteinase EC= 2. 3.4.24.- 3. Disintegrin jararin
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Snake venom zinc metalloproteinase that inhibits ADP-induced platelet aggregation (probably by binding integrin alpha-IIb/beta-3 (ITGA2B/ITGB3)) and degrades fibrinogen.
Subcellular Location Secreted
Protein Families Venom metalloproteinase (M12B) family, P-II subfamily, P-IIb sub-subfamily
Tissue Specificity Expressed by the venom gland.

Product Details for Different Expression Systems

Product Name Recombinant Bothrops jararaca Zinc metalloproteinase/disintegrin,Yeast
Code CSB-YP603891BUW
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence SPPFCGNYYPEVGEDCDCGPPANCQNPCCDAATCKLTTGSQCAEGLCCDQCKFIKARQIC RKGRGDNPDDRCTGQSGDCPRNS
Expression Region 74-156
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bothrops jararaca Zinc metalloproteinase/disintegrin,E.coli
Code CSB-EP603891BUW
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence SPPFCGNYYPEVGEDCDCGPPANCQNPCCDAATCKLTTGSQCAEGLCCDQCKFIKARQIC RKGRGDNPDDRCTGQSGDCPRNS
Expression Region 74-156
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bothrops jararaca Zinc metalloproteinase/disintegrin,Baculovirus
Code CSB-BP603891BUW
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence SPPFCGNYYPEVGEDCDCGPPANCQNPCCDAATCKLTTGSQCAEGLCCDQCKFIKARQIC RKGRGDNPDDRCTGQSGDCPRNS
Expression Region 74-156
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bothrops jararaca Zinc metalloproteinase/disintegrin,Mammalian cell
Code CSB-MP603891BUW
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence SPPFCGNYYPEVGEDCDCGPPANCQNPCCDAATCKLTTGSQCAEGLCCDQCKFIKARQIC RKGRGDNPDDRCTGQSGDCPRNS
Expression Region 74-156
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.