Recombinant Bovine Pregnancy-associated protein bPAP

Code CSB-BP307176BO
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. P84291
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence DSELAGPRGARGPHGLSGPHGLSGLXGPXGYTGPIGMXGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW
Research Area others
Source Baculovirus
Gene Names N/A
Protein Names Recommended name: Pregnancy-associated protein bPAP
Expression Region 1-100aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal MBP-tagged and C-terminal 6xHis-tagged
Mol. Weight 54.3 kDa
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.