Recombinant Bovine Interferon alpha-G(IFNAG)

Code CSB-EP344226BO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P49877
Relevance Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias IFN-alpha7
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD
Research Area Immunology
Source E.coli
Gene Names IFNAG
Expression Region 24-189aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 35.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Database Links

KEGG: bta:100329206

STRING: 9913.ENSBTAP00000056397

UniGene: Bt.416

Related Products

IFNAG Antibodies

IFNAG Antibodies for Bovine

IFNAG Antibodies for Bos taurus (Bovine)

IFNAG Proteins

IFNAG Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.